Seitvertreib. Das Leben ist zu kurz, um nicht zu lachen.

Seitvertreib RSS Feed via feedly abonnieren

Archiv des Tags ‘afrika’

Flußüberquerung in Somalia

1. Dezember 2016

Zwei steckengebliebene Lastwagen blockieren eine überschwemmte Furt der Road Number 1 (hier auf Google Maps) in Somalia und daraus wird ein interessanter Einblick in afrikanische Transportschwierigkeiten: schafft er’s noch rüber?

Crossing A River in Somaliland

DirektYoutube

via reddit

A Drone Through Africa

28. November 2016

Na der Titel sagt ja schon alles, obwohl ich glaube, dass 90% der Aufnahmen im südlichen Afrika entstanden sind, vielleicht weil der Fotograf naudewashere aus Kapstadt kommt.
Und es wirkt vielleicht ein bisschen wie ein Tourismuswerbefilm mit den posierenden Menschen, ist aber trotzdem sehr schön.

[P.S.: Wie sich herausgestellt hat (weil das Video von naudewashere verschwunden ist), ist das tatsächlich ein Werbespot für eine Hotelkette und die Bilder sind alle in Südafrika, Botswana und Sambia entstanden. Was wo aufgenommen wurde, steht in der Beschreibung auf Youtube. Danke Gilly für den Hinweis!]

A Drone Through Africa

DirektYoutube

via kuriositas

Bester Werbespot der Woche: Alive Inside (Guinness Africa Special)

13. April 2016

Kibwe Tavares - Regisseur des meiner Meinung nach besten Roboterfilms des Jahres 2011, Robots of Brixton - liefert hier für Guinness’ (mit 2 n!) neues Afrikabier (?) einen wirklich erstklassigen Manmusseinfachmitwackelnmitdiesenrhythmischenbildernwerbespot ab.

Alive Inside

Direktvimeo

via Stash

»Undisturbed Places« - (nicht nur) Nachthimmel-Timelapse aus Namibia und Botswana

21. Februar 2016

Maciej Tomków war einen Monat lang mit der Namib & Kalahari Desert Astroexpedition in Namibia und Botswana unterwegs. Orte, die zu den am wenigsten »lichtverschmutzten« Plätzen auf dieser Erde gehören und deshalb für Nachthimmelzeitrafferaufnahmen perfekt geeignet sind.
Und das kann man in der Tat sehen:

Undisturbed Places - A Timelapse Film

Direktvimeo

Lichtverschmutzung wirkt sich laut Wikipedia auf den Nachthimmel übrigens so aus:

»Sichtbarer Sternenhimmel in der Großstadt und auf dem Land, Sternbild Stier«

Taurus 3m-6m

By Akroti (Own work) [Public domain], via Wikimedia Commons

via HD Time

Der vielleicht sympathischste Kakaobauer der Welt probiert zum ersten Mal in seinem Leben Schokolade

11. Februar 2016

Adrien Kouadio, der nette Kakaobauer aus dem Ort Paul Kru in der Elfenbeinküste, reist nach England, um dort eine Schokoladenfabrik zu besuchen und das erste Mal im Leben Schokolade zu probieren. Anscheinend haben viele Kakaobauern noch nie Schokolade gegessen (warum auch immer, vielleicht weil das zu teuer ist?), unglaublich, oder?

Die Menschen von Nice and Serious haben auch im zweiten Teil der Kampagne für die Rainforest Alliance die fröhliche Natur von Adrien sehr schön eingefangen. Und weil wahrscheinlich alle internetbrowsenden Individuen genauso klickfaul sind wie ich, gibts den ersten Teil des Kakaoportraits hier nochmal gratis dazu ;-)

Teil 1: The Man Behind Your Chocolate - Rainforest Alliance

Direktvimeo

Teil 2 (die Reise nach England): Rainforest Alliance | The Road to Better Beginnings

Direktvimeo

via vimeo

No Elefantenklo

6. August 2015

Den Grund für diesen Toilettenelefanten und ein paar deutlichere Elefanten-Fotos gibts hier.
The elephant in the bathroom

DirektYoutube

via Nothing To Do With Arbroath

In Ghana gibt es professionelle Sargträger-Tänzer

9. Juli 2015

In Ghana gibt’s anscheinend nicht nur unglaubliche Sargkreationen (einfach mal nach »Sargkunst Ghana« bild-googlen oder den Wikipediaartikel dazu lesen), dort wird bei Beerdigungen auch mit dem Sarg getanzt. Mit dem gefüllten Sarg, wie ich jetzt mal annehme (ich war einfach zu faul, das jetzt auch noch zu googlen, aber wenn du da genaueres weißt, gerne in die Kommentare damit! Ach nee, auch zu faul, was? ;-) ). Also auf jeden Fall ist eine Beerdigung stimmungsmäßig eine ganz andere Angelegenheit in Ghana als bei uns, weil man dort den Tod nicht als unbestimmtes Ende wahrnimmt. Irgendwie beneidenswert. Und ziemlich cool. Ich würde sowas ja gern mal auf einem bayerischen Friedhof mit Trachtenanzügen sehen…

Professional Dancing Pallbearers - Ghana von Travelin Sister

DirektYoutube

via YouTube-empfohlene Videos (warum auch immer mir das dort angezeigt wurde)

African DnB Fan (wie kann man bitteschön obenrum so ruhig sein, wenn untenrum die Post abgeht?)

1. Juni 2015

Jemand hat auf geniale Weise einen Zaouli Tänzer von der Elfenbeinküste mit Drum and Bass verheiratet und die beiden passen wirklich unheimlich gut zusammen. Und ich finde es auch nach dem 10. Anschauen noch unglaublich, dass man untenrum so hektisch rumtanzen kann und der Oberkörper dabei trotzdem total still rumzustehen scheint, als ob ihn das Ganze gar nichts angehen würde. Waaaaahnsinn!
Das Originalvideo ohne DnB gibts hier: Mask collective + Festima - Zaouli de la Côte d’Ivoire.

African DnB Fan

DirektYoutube

via nerddrugs