Seitvertreib. Das Leben ist zu kurz, um nicht zu lachen.

Archiv des Tags ‘afrika’

Ein Gorilla stoppt den Verkehr, damit seine Familie sicher die Strasse überqueren kann

2. Januar 2018

Die Überschrift ist ja eigentlich ein kleines bisschen irreführend, aber irgendwie stimmt es ja, so wie der riesige Gorilla auf der Strasse stehenbleibt. Sieht beeindruckend aus.
Elefanten machen das übrigens genauso.

Silverback gorilla stops traffic to cross road - Gorilla Family and Me - BBC Earth

DirektYoutube

via Laughing Squid

Hier wurde ein echtes Wunder gefilmt!

22. Februar 2017

Das lässt einen doch irgendwie sprachlos zurück.

Undeniable Miracle

DirektYoutube

via Koreus

Flußüberquerung in Somalia

1. Dezember 2016

Zwei steckengebliebene Lastwagen blockieren eine überschwemmte Furt der Road Number 1 (hier auf Google Maps) in Somalia und daraus wird ein interessanter Einblick in afrikanische Transportschwierigkeiten: schafft er’s noch rüber?

Crossing A River in Somaliland

DirektYoutube

via reddit

A Drone Through Africa

28. November 2016

Na der Titel sagt ja schon alles, obwohl ich glaube, dass 90% der Aufnahmen im südlichen Afrika entstanden sind, vielleicht weil der Fotograf naudewashere aus Kapstadt kommt.
Und es wirkt vielleicht ein bisschen wie ein Tourismuswerbefilm mit den posierenden Menschen, ist aber trotzdem sehr schön.

[P.S.: Wie sich herausgestellt hat (weil das Video von naudewashere verschwunden ist), ist das tatsächlich ein Werbespot für eine Hotelkette und die Bilder sind alle in Südafrika, Botswana und Sambia entstanden. Was wo aufgenommen wurde, steht in der Beschreibung auf Youtube. Danke Gilly für den Hinweis!]

A Drone Through Africa

DirektYoutube

via kuriositas

Bester Werbespot der Woche: Alive Inside (Guinness Africa Special)

13. April 2016

Kibwe Tavares - Regisseur des meiner Meinung nach besten Roboterfilms des Jahres 2011, Robots of Brixton - liefert hier für Guinness’ (mit 2 n!) neues Afrikabier (?) einen wirklich erstklassigen Manmusseinfachmitwackelnmitdiesenrhythmischenbildernwerbespot ab.

Alive Inside

Direktvimeo

via Stash

»Undisturbed Places« - (nicht nur) Nachthimmel-Timelapse aus Namibia und Botswana

21. Februar 2016

Maciej Tomków war einen Monat lang mit der Namib & Kalahari Desert Astroexpedition in Namibia und Botswana unterwegs. Orte, die zu den am wenigsten »lichtverschmutzten« Plätzen auf dieser Erde gehören und deshalb für Nachthimmelzeitrafferaufnahmen perfekt geeignet sind.
Und das kann man in der Tat sehen:

Undisturbed Places - A Timelapse Film

Direktvimeo

Lichtverschmutzung wirkt sich laut Wikipedia auf den Nachthimmel übrigens so aus:

»Sichtbarer Sternenhimmel in der Großstadt und auf dem Land, Sternbild Stier«

Taurus 3m-6m

By Akroti (Own work) [Public domain], via Wikimedia Commons

via HD Time

Der vielleicht sympathischste Kakaobauer der Welt probiert zum ersten Mal in seinem Leben Schokolade

11. Februar 2016

Adrien Kouadio, der nette Kakaobauer aus dem Ort Paul Kru in der Elfenbeinküste, reist nach England, um dort eine Schokoladenfabrik zu besuchen und das erste Mal im Leben Schokolade zu probieren. Anscheinend haben viele Kakaobauern noch nie Schokolade gegessen (warum auch immer, vielleicht weil das zu teuer ist?), unglaublich, oder?

Die Menschen von Nice and Serious haben auch im zweiten Teil der Kampagne für die Rainforest Alliance die fröhliche Natur von Adrien sehr schön eingefangen. Und weil wahrscheinlich alle internetbrowsenden Individuen genauso klickfaul sind wie ich, gibts den ersten Teil des Kakaoportraits hier nochmal gratis dazu ;-)

Teil 1: The Man Behind Your Chocolate - Rainforest Alliance

Direktvimeo

Teil 2 (die Reise nach England): Rainforest Alliance | The Road to Better Beginnings

Direktvimeo

via vimeo

No Elefantenklo

6. August 2015

Den Grund für diesen Toilettenelefanten und ein paar deutlichere Elefanten-Fotos gibts hier.
The elephant in the bathroom

DirektYoutube

via Nothing To Do With Arbroath