Seitvertreib. Das Leben ist zu kurz, um nicht zu lachen.

Archiv des Tags ‘afrika’

Live-Webcam an einem Wasserloch in der Wüste Namib

21. Dezember 2021

Die Wüste Namib liegt im Südwesten Afrikas. Der Ort der Webcam ist Deutschland nur eine Stunde voraus.

Namibia: Live stream in the Namib Desert


via Youtube

Salliou playing the cas cas – Kashaka-Musik aus dem Senegal

5. August 2018

Cas Cas – oder Kashaka wie Wikipedia sie nennt – bestehen aus zwei bohnengefüllten Rasseln aus Kürbissen, die richtig gespielt unglaublich gute Rhythmen erzeugen können. So unglaublich gut, dass ich erst dachte, dass im Video hier unten noch Musik druntergelegt wurde. Ist aber nicht so, das zeigt sich spätestens, als Salliou die Wasserflasche umstellt.
Tolltolltoll, was es so alles an Instrumenten (und talentierten Musikern) gibt!

Salliou playing the cas cas von Nick Jennings


via kotaro269

Ein Gorilla stoppt den Verkehr, damit seine Familie sicher die Strasse überqueren kann

2. Januar 2018

Die Überschrift ist ja eigentlich ein kleines bisschen irreführend, aber irgendwie stimmt es ja, so wie der riesige Gorilla auf der Strasse stehenbleibt. Sieht beeindruckend aus.
Elefanten machen das übrigens genauso.

Silverback gorilla stops traffic to cross road – Gorilla Family and Me – BBC Earth


via Laughing Squid

Hier wurde ein echtes Wunder gefilmt!

22. Februar 2017

Das lässt einen doch irgendwie sprachlos zurück.

Undeniable Miracle


via Koreus

Flußüberquerung in Somalia

1. Dezember 2016

Zwei steckengebliebene Lastwagen blockieren eine überschwemmte Furt der Road Number 1 (hier auf Google Maps) in Somalia und daraus wird ein interessanter Einblick in afrikanische Transportschwierigkeiten: schafft er’s noch rüber?

Crossing A River in Somaliland


via reddit

A Drone Through Africa

28. November 2016

Na der Titel sagt ja schon alles, obwohl ich glaube, dass 90% der Aufnahmen im südlichen Afrika entstanden sind, vielleicht weil der Fotograf naudewashere aus Kapstadt kommt.
Und es wirkt vielleicht ein bisschen wie ein Tourismuswerbefilm mit den posierenden Menschen, ist aber trotzdem sehr schön.

[P.S.: Wie sich herausgestellt hat (weil das Video von naudewashere verschwunden ist), ist das tatsächlich ein Werbespot für eine Hotelkette und die Bilder sind alle in Südafrika, Botswana und Sambia entstanden. Was wo aufgenommen wurde, steht in der Beschreibung auf Youtube. Danke Gilly für den Hinweis!]

A Drone Through Africa


via kuriositas

Bester Werbespot der Woche: Alive Inside (Guinness Africa Special)

13. April 2016

Kibwe Tavares – Regisseur des meiner Meinung nach besten Roboterfilms des Jahres 2011, Robots of Brixton – liefert hier für Guinness‘ (mit 2 n!) neues Afrikabier (?) einen wirklich erstklassigen Manmusseinfachmitwackelnmitdiesenrhythmischenbildernwerbespot ab.

Alive Inside


via Stash

»Undisturbed Places« – (nicht nur) Nachthimmel-Timelapse aus Namibia und Botswana

21. Februar 2016

Maciej Tomków war einen Monat lang mit der Namib & Kalahari Desert Astroexpedition in Namibia und Botswana unterwegs. Orte, die zu den am wenigsten »lichtverschmutzten« Plätzen auf dieser Erde gehören und deshalb für Nachthimmelzeitrafferaufnahmen perfekt geeignet sind.
Und das kann man in der Tat sehen:

Undisturbed Places – A Timelapse Film


Lichtverschmutzung wirkt sich laut Wikipedia auf den Nachthimmel übrigens so aus:

»Sichtbarer Sternenhimmel in der Großstadt und auf dem Land, Sternbild Stier«

Taurus 3m-6m

By Akroti (Own work) [Public domain], via Wikimedia Commons

via HD Time